PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013901219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family G2-like
Protein Properties Length: 663aa    MW: 71652.1 Da    PI: 5.9983
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013901219.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like833.2e-26520572255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      rl+Wtp LH+rF eav++L G +k +Pkti+ +mkv+gLt+e+v+SHLQkYRl
  XP_013901219.1 520 SRLVWTPSLHKRFEEAVHSL-GVDKCVPKTIMSIMKVDGLTRENVASHLQKYRL 572
                     79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.414516575IPR017930Myb domain
SuperFamilySSF466893.76E-17517575IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-27518575IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-22520573IPR006447Myb domain, plants
PfamPF002494.1E-7522571IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MLARSGLASG KPYEGDRMEV DVCSSPLCSS LGDGDLLPLD QISLVSPGLA EAFGITTSLG  60
LRDERPRGPS SDDGIGSGDL GQQRFLGGDD SLRLADGFDS PPLSDEPVHR APSDTSGGAV  120
GGHHHEAGGG ALAAVAAAAR AVHEAHEHHR VLQEQHEREQ QHQQQQWILY EQQQQQFMLL  180
QQRQQQEAEE QQEQQQQQQQ QQAAGLEFEA AQAQQLRQHQ ESQHEHDHQL QLERHQLDQQ  240
QLEQQQQHQQ QHQHQQQQQL EQQHMEQQQH HQHLEQQHQH AQQHQAQQQH HAALAAAAAA  300
AQVVQFSHSQ SASMSGVPPA TAGYLAGMLP YSTYGAAAAA AAAAAAAAGQ LPGYPYPLPG  360
MLPYLQAMPG AYAYPGAYPS SAFDFIMQQQ QAVAAAAAAA QQAAAAQQEH SGQQAALPLA  420
LDGQNEAAHK PPTLAAVEQQ QQHHQPQPPQ QQQQHAQQKH QQQHQQQHQQ PPPQQHQPTP  480
EHAPHKEQHP QQQSQQPPSA WPAECTGEDS DPHPHALKRS RLVWTPSLHK RFEEAVHSLG  540
VDKCVPKTIM SIMKVDGLTR ENVASHLQKY RLQLKAKQGE EDRKRRRAAA QARAQAARAA  600
AAGGGAAAPV QPEAGEGAEG AEGPQGAQGV AYEEGGGEAA AEATEADAAD GAWASEQAVM  660
GAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15516575261ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1582586RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00056PBMTransfer from AT5G05090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013901219.10.0Two-component response regulator ARR1
TrEMBLA0A0D2MGJ80.0A0A0D2MGJ8_9CHLO; Two-component response regulator ARR1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.12e-24G2-like family protein
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]